PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G161100.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 492aa    MW: 53018.8 Da    PI: 8.2898
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G161100.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.53e-14192231241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++++C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Seita.9G161100.3.p 192 SCRRCSCKKSKCLKLYCACFAAKVYCSGFCSCQGCLNNHT 231
                         6899*********************************987 PP

2TCR51.42.2e-16277316140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Seita.9G161100.3.p 277 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 316
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-13191232IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.538192317IPR005172CRC domain
PfamPF036383.3E-10194229IPR005172CRC domain
SMARTSM011141.5E-14277318IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.6E-12279315IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MMSYLANPSC QWIKETRRIH KKKKFDGSTG CYIQSAADNA HVYCAGATEG VATNHDPEML  60
PGVIQSQLVS NEYFFDTFKV PSDDMALSED QCGRLHRCSL FNEKVGASDM SVQSGSNPHL  120
ANICGDNYLK PAGSPVYALP VSCSETGLYS SEVYTRIHDD HSSQKTMPNA NESCQESHKK  180
KRRKLQNGDG DSCRRCSCKK SKCLKLYCAC FAAKVYCSGF CSCQGCLNNH THEETVSCIR  240
KRTESRNPLA FAPTVTRACD SGSDFGDNSN NTPASARHKR GCNCRKSSCL KKYCECFQSG  300
VGCSMSCRCE SCKNSFGKRE GVLLLATAKM EKGAKAKGTR STEEKLAFDK QDVVGQSGDL  360
PSTENLFATP SLGPCRSSIL PPSTCSEPPL STAGYSSRLH NSQSPIKADV LLSYFDTCAA  420
EMIVGDGSAN IQEVGSSCIS SVKVVSPNKK RVSPLHTGTG LSPIGRSGRK LVLKSIPSFP  480
SLTGDADSEP H*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178182KKKRR
2178183KKKRRK
3179183KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698176.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X2
SwissprotF4JIF51e-76TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLK4A7550.0K4A755_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-64TESMIN/TSO1-like CXC 2